TCAL7_MOUSE 98 Transcription elongation factor A protein-like 7 Transcription elongation factor S-II protein-like 7 Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines (By similarity). Tceal7 MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQRLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDHPF